Invitrogen™ Human SLC11A1 (aa 306-345) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108881	100 μL

Catalog No. RP108881 Supplier Invitrogen™ Supplier No. RP108881

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139811. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NRAMP1, also known as SLC11A1, is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as leprosy and tuberculosis, and inflammatory diseases such as Crohn disease and rheumatoid arthritis. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Specifications

• Accession Number: P49279
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6556
• Name: Human SLC11A1 (aa 306-345) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Bcg; host resistance locus Bcg/Ity/Lsh; integral membrane protein; Itg; Ity; Lsh; natural resistance associated macrophage protein; natural resistance associated macrophage protein 1; natural resistance-associated macrophage protein; natural resistance-associated macrophage protein 1; natural resistance-associated macrophages protein 1; NRAMP; NRAMP 1; Nramp1; Slc11a1; solute carrier 11 family member 1; solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1; solute carrier family 11 (sodium/phosphate symporters), member 1; solute carrier family 11 A1; solute carrier family 11 member 1; solute carrier family 11 member a1
• Common Name: SLC11A1
• Gene Symbol: SLC11A1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining