Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human SLC12A3 (aa 844-988) Control Fragment Recombinant Protein

Catalog No. RP102376
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102376 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102376 Supplier Invitrogen™ Supplier No. RP102376
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55969. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SLC12A3 gene encodes the thiazide-sensitive sodium-chloride symporter (NCC), which is critical for salt balance and blood pressure regulation in humans. This symporter is predominantly expressed in the distal convoluted tubule of the kidney, where it facilitates the reabsorption of sodium and chloride ions from the renal filtrate back into the bloodstream. NCC activity plays a vital role in maintaining extracellular fluid volume and potassium homeostasis, impacting systemic blood pressure. Mutations in SLC12A3 can lead to Gitelman syndrome, a hereditary salt-wasting disorder characterized by hypokalemic metabolic alkalosis, low blood pressure, and hypomagnesemia. This gene is regulated by the renin-angiotensin system, which modulates NCC activity through phosphorylation mediated by WNK kinases, thereby affecting renal sodium handling and blood pressure modulation. Research highlights the therapeutic potential of targeting NCC with thiazide diuretics to treat hypertension, emphasizing its importance in both physiological and pathological contexts. The dynamic regulation of NCC by hormonal pathways underscores its significance in fluid and electrolyte balance, contributing to cardiovascular health.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55017
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6559
Name Human SLC12A3 (aa 844-988) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI035291; chemokine (C-C); CKb10; CK-beta-10; MCP-4; MGC17134; Na-Cl cotransporter; NaCl electroneutral thiazide-sensitive cotransporter; Na-Cl symporter; Ncc; NCC1; NCC-1; NCCT; SCYA13; SCYL1; si:ch211-122c9.4; SLC12A3; sodium chloride cotransporter; solute carrier family 12 (sodium/chloride transporter), member 3; solute carrier family 12 (sodium/chloride transporters), member 3; solute carrier family 12 member 3; solute carrier family 12, member 3; thiazide-sensitive Na-Cl cotransporter; thiazide-sensitive sodium chloride cotransporter; thiazide-sensitive sodium-chloride cotransporter; TSC; wu:fj83c03
Common Name SLC12A3
Gene Symbol Slc12a3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.