Invitrogen™ Human SLC17A1 (aa 39-79) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106288	100 μL

Catalog No. RP106288 Supplier Invitrogen™ Supplier No. RP106288

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC17A1 (Solute Carrier Family 17 Member 1) is a Protein Coding gene. Diseases associated with SLC17A1 include Gout and Hyperuricemia. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Uricosurics Pathway, Pharmacodynamics. Gene Ontology (GO) annotations related to this gene include symporter activity and phosphate ion transmembrane transporter activity. An important paralog of this gene is SLC17A2. Also, it is involved in cotransport of sodium and phosphate.

Specifications

• Accession Number: Q14916
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6568
• Name: Human SLC17A1 (aa 39-79) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Na(+)/PI cotransporter 1; Na/Pi-4; Napi1; Napi-1; Npt1; NPT-1; OATV1; organic anion transporter OATv1; renal Na(+)-dependent phosphate cotransporter 1; Renal sodium-dependent phosphate transport protein 1; renal sodium-phosphate transport protein 1; Slc17a1; sodium phosphate transporter; sodium/phosphate cotransporter 1; sodium/phosphate type I cotransporter; sodium-dependent phosphate transport protein 1; sodium-dependent phosphate/anion cotransporter; solute carrier family 17 (organic anion transporter), member 1; solute carrier family 17 (sodium phosphate), member 1; solute carrier family 17 (sodium/hydrogen exchanger), member 1; solute carrier family 17 (vesicular glutamate transporter), member 1; solute carrier family 17 member 1; solute carrier family 17 vesicular glutamate transporter), member 1
• Common Name: SLC17A1
• Gene Symbol: Slc17a1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining