Invitrogen™ Human SLC22A13 (aa 500-550) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96458	100 μL

Catalog No. RP96458 Supplier Invitrogen™ Supplier No. RP96458

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.

Specifications

• Accession Number: Q9Y226
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9390
• Name: Human SLC22A13 (aa 500-550) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI648912; OAT10; OCTL1; OCTL3; ORCTL3; ORCTL-3; Organic cation transporter-like 3; organic cationic transporter-like 3; organic-cation transporter like 3; Slc22a13; solute carrier family 22 (organic anion transporter), member 13; solute carrier family 22 (organic anion/urate transporter), member 13; solute carrier family 22 (organic cation transporter), member 13; solute carrier family 22 member 13; solute carrier family 22, member 13
• Common Name: SLC22A13
• Gene Symbol: SLC22A13
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining