Invitrogen™ Human SLC22A18 (aa 203-243) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107818	100 μL

Catalog No. RP107818 Supplier Invitrogen™ Supplier No. RP107818

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67175. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ORCTL2 (organic cation transporter-like protein 2), also known as HET, ITM, BWR1A, IMPT1, TSSC5, BWSCR1A, SLC22A1L, p45-BWR1A or SLC22A18, is a 424 amino acid multi-pass membrane protein that localizes at the apical membrane surface of renal proximal tubules. ORCTL2 is expressed at high levels in the kidney, liver, colon and in fetal renal proximal tubules and present at lower levels in heart, brain and lung. Belonging to the major facilitator superfamily, ORCTL2 may act as a transporter of organic cations based on a proton efflux antiport mechanism and may also play a role in the transport of chloroquine and quinidine-related compounds in kidney. Defects in ORCTL2 are associated with breast and lung cancer and are the cause of rhabdomyosarcoma type 1, a malignant tumor derived from striated muscle.

Specifications

• Accession Number: Q96BI1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5002
• Name: Human SLC22A18 (aa 203-243) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW260131; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein; BWR1A; BWSCR1A; Efflux transporter-like protein; HET; imprinted multi-membrane spanning polyspecific transporter-related protein 1; imprinted multi-membrane-spanning polyspecific transporter-related protein 1; Impt1; ITM; Multi-membrane-spanning polyspecific transporter; ORCTL2; ORCTL-2; Organic cation transporter-like protein 2; organic cationic transporter-like 2; p45 Beckwith-Wiedemann region 1A; p45-Beckwith-Wiedemann region 1 A; p45-BWR1A; SLC22A18; SLC22A1L; solute carrier family 22 (organic cation transporter), member 18; Solute carrier family 22 member 18; Solute carrier family 22 member 1-like; solute carrier family 22, member 18; TSSC5; tumor suppressing subtransferable candidate 5; tumor-suppressing STF cDNA 5 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
• Common Name: SLC22A18
• Gene Symbol: SLC22A18
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining