Invitrogen™ Human SLC22A2 (aa 285-345) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101762	100 μL

Catalog No. RP101762 Supplier Invitrogen™ Supplier No. RP101762

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Organic cation transporters (OCT) are expressed in the plasma membrane of epithelial cells from a wide range of tissues, where they function in the elimination of endogenous amines, cationic drugs and other xenobiotics. The structure of OCTs consists of a 12-transmembrane-domain structure and a large extracellular hydrophilic loop. In humans, OCT1 is primarily expressed in the liver, while OCT2 is expressed in the kidney. OCT3 is expressed in the placenta, skeletal muscle, prostate, aorta and liver. OCT2, also known as SLC22A2, is a multi-specific transporter protein localizing to the basolateral and luminal membranes of the kidney distal tubule and proximal tubules. OCT2 is responsible for mediating the pH-sensitive tubular uptake of organic compounds from circulation. An additional splice variant exists for OCT2, namely OCT2-A.

Specifications

• Accession Number: O15244
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6582
• Name: Human SLC22A2 (aa 285-345) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2-Oct; hOCT2; OCT2; OCT2r; Orct2; Organic cation transporter 2; rOCT2; Slc22a2; solute carrier family 22 (organic cation transporter), member 2; solute carrier family 22 member 2; solute carrier family 22, member 2
• Common Name: SLC22A2
• Gene Symbol: Slc22a2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining