Invitrogen™ Human SLC22A7 (aa 517-548) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94861	100 μL

Catalog No. RP94861 Supplier Invitrogen™ Supplier No. RP94861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56402. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described. The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Specifications

• Accession Number: Q9Y694
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10864
• Name: Human SLC22A7 (aa 517-548) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: hOAT2; liver-specific transporter; MGC24091; MGC45202; mOAT2; NLT; novel liver transporter; oat2; organic anion transporter 2; rbOAT2; renal organic anion transporter 2; Slc22a7; solute carrier family 22 (organic anion transporter), member 7; solute carrier family 22 member 7; solute carrier family 22 member 7; LOW QUALITY PROTEIN: solute carrier family 22 member 7
• Common Name: SLC22A7
• Gene Symbol: SLC22A7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QAQLPETIQDVERKSAPTSLQEEEMPMKQVQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining