Invitrogen™ Human SLC25A25 (aa 83-171) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93011	100 μL

Catalog No. RP93011 Supplier Invitrogen™ Supplier No. RP93011

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82724. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.

Specifications

• Accession Number: Q6KCM7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 114789
• Name: Human SLC25A25 (aa 83-171) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110030N17Rik; APC3; ATP-Mg/Pi carrier; calcium-binding mitochondrial carrier protein SCaMC-2; Kiaa1896; LOW QUALITY PROTEIN: calcium-binding mitochondrial carrier protein SCaMC-2; MCSC; MCSC3; Mitochondrial ATP-Mg/Pi carrier protein; mitochondrial ATP-Mg/Pi carrier protein 3; Mitochondrial Ca(2+)-dependent solute carrier protein 3; mitochondrial Ca2+-dependent solute carrier; mKIAA1896; Pcscl; peroxisomal Ca(2+)-dependent solute carrier-like protein; peroxisomal Ca-dependent solute carrier-like protein; Scamc2; SCAMC-2; short calcium-binding mitochondrial carrier 2; SLC25A25; small calcium-binding mitochondrial carrier 2; small calcium-binding mitochondrial carrier protein 2; solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25; solute carrier family 25 member 25; Unknown (protein for MGC:127973); UNQ549/PRO1106
• Common Name: SLC25A25
• Gene Symbol: SLC25A25
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining