Invitrogen™ Human SLC26A9 (aa 1-43) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99802	100 μL

Catalog No. RP99802 Supplier Invitrogen™ Supplier No. RP99802

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62417. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.

Specifications

• Accession Number: Q7LBE3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 115019
• Name: Human SLC26A9 (aa 1-43) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Anion transporter/exchanger protein 9; anion transporter/exchanger-9; E030002L01Rik; SLC26A9; SLC26A9 anion transporter/exchanger; solute carrier family 26 (anion exchanger), member 9; solute carrier family 26 member 9; solute carrier family 26, member 9
• Common Name: SLC26A9
• Gene Symbol: SLC26A9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining