Invitrogen™ Human SLC2A8 (aa 206-256) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89665	100 μL

Catalog No. RP89665 Supplier Invitrogen™ Supplier No. RP89665

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52877. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.

Specifications

• Accession Number: Q9NY64
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29988
• Name: Human SLC2A8 (aa 206-256) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D2Ertd44e; Glucose transporter type 8; glucose transporter type X1; glucose transporter X1; Glut8; GLUT-8; GLUTX1; intestinal GLUT8 transporter; SLC2A8; solute carrier family 2 (facilitated glucose transporter), member 8; solute carrier family 2 member 8; solute carrier family 2, (facilitated glucose transporter) member 8; solute carrier family 2, (facilitated glucose transporter), member 8; solute carrier family 2, facilitated glucose transporter member 8
• Common Name: SLC2A8
• Gene Symbol: SLC2A8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining