Invitrogen™ Human SLC38A2 (aa 244-287) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109995	100 μL

Catalog No. RP109995 Supplier Invitrogen™ Supplier No. RP109995

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144976. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.

Specifications

• Accession Number: Q96QD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54407
• Name: Human SLC38A2 (aa 244-287) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5033402L14Rik; AI316867; amino acid system A transporter; amino acid transporter 2; amino acid transporter A2; amino acid transporter cationic 2; amino acid transporter system A2; amino acid transporter, cationic 2 (low affinity); ATA2; Atrc2; Kiaa1382; mKIAA1382; PRO1068; Protein 40-9-1; Sa1; Sat2; SLC38A2; Snat2; sodium-coupled neutral amino acid transporter 2; Solute carrier family 38 member 2; solute carrier family 38, member 2; system A amino acid transporter 2; System A transporter 1; system N amino acid transporter 2
• Common Name: SLC38A2
• Gene Symbol: SLC38A2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining