Invitrogen™ Human SLC3A1 (aa 111-195) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108578	100 μL

Catalog No. RP108578 Supplier Invitrogen™ Supplier No. RP108578

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84856. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.

Specifications

• Accession Number: Q07837
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6519
• Name: Human SLC3A1 (aa 111-195) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: amino acid transport related protein; amino acid transporter 1; amino acid transporter SLC3A1; ATR1; b(0,+)-type amino acid transport protein; CSNU1; D2; D2H; FLJ34681; membrane glycoprotein; NAA-TR; Nbat; Neutral and basic amino acid transport protein rBAT; NTAA; rBAT; rBAT protein; si:dkey-202m23.2; Slc3a1; SLC3A1 variant B; SLC3A1 variant C; SLC3A1 variant D; SLC3A1 variant E; SLC3A1 variant F; SLC3A1 variant G; solute carrier family 3 (amino acid transporter heavy chain), member 1; solute carrier family 3 (cystine, dibasic and neutral amino acid transporters), member 1; solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1; solute carrier family 3 member 1; solute carrier family 3, member 1
• Common Name: SLC3A1
• Gene Symbol: SLC3A1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining