Invitrogen™ Human SLC51B (aa 77-127) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88590	100 μL

Catalog No. RP88590 Supplier Invitrogen™ Supplier No. RP88590

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The heteromeric transporter OST Alpha/OST Beta facilitates the transport of bile and other steroid solutes across the basolateral epithelial cell membrane of intestine, liver, testis, kidney and adrenal gland. OST Alpha/OST Beta expression is induced by bile acids through ligand-dependent transactivation of their genes by FXR (Farnesoid X-activated receptor). This genetic regulation suggests that in response to changes in intracellular bile acid levels, bile acids adjust the rate of their own efflux from enterocytes. OST Beta is a 128 amino acid single-pass transmembrane protein that requires OST Alpha to localize to the plasma membrane. Coexpression of OST Alpha and OST Beta is also required to convert the OST Alpha subunit to a mature glycosylated endoglycosidase H-resistant form, suggesting that co-expression facilitates trafficking of OST Alpha through the golgi apparatus. Though widely expressed, OST Beta is present at highest levels in ileum.

Specifications

• Accession Number: Q86UW2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 123264
• Name: Human SLC51B (aa 77-127) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: organic solute transporter beta; organic solute transporter beta subunit; organic solute transporter subunit beta; Ost beta; Ostb; Ostbeta; OST-beta; RGD1565748; Slc51b; solute carrier family 51 beta subunit; solute carrier family 51 subunit beta; solute carrier family 51, beta subunit
• Common Name: SLC51B
• Gene Symbol: SLC51B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining