Invitrogen™ Human SMURF1 (aa 153-230) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108738	100 μL

Catalog No. RP108738 Supplier Invitrogen™ Supplier No. RP108738

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the transforming growth factor-beta (TGFB) family signal through type I and type II serine/threonine-kinase receptors, which in turn activate the SMAD signaling pathway. Bone morphogenetic protein (BMP) receptors target SMAD1, SMAD5, and SMAD8, whereas receptors for activin and TGFB (e. g., ACVR1 and TGFBR1, respectively) target SMAD2 and SMAD3. Phosphorylation of these receptor-regulated SMADs induces their association with the common-partner SMAD, SMAD4. Smurf1, a HECT domain E3 ubiquitin ligase, regulates cell polarity and protrusive activity and is required to maintain the transformed morphology and motility of a tumor cell. Atypical protein kinase C-zeta (PKC2), an effector of the Cdc42/Rac1-PAR6 polarity complex, recruits Smurf1 to cellular protrusions, where it controlled the local level of RhoA. Smurf1 thus links the polarity complex to degradation of RhoA in lamellipodia and filopodia to prevent RhoA signaling during dynamic membrane movements.

Specifications

• Accession Number: Q9HCE7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57154
• Name: Human SMURF1 (aa 153-230) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930431E10Rik; E3 ubiquitin ligase SMURF1; E3 ubiquitin ligase SMURF2; E3 ubiquitin-protein ligase SMURF1; E3 ubiquitin-protein ligase SMURF2; HECT-type E3 ubiquitin transferase SMURF1; HECT-type E3 ubiquitin transferase SMURF2; hSMURF1; hSMURF2; KIAA1625; mKIAA1625; RGD1309707; SMAD specific E3 ubiquitin protein ligase 1; SMAD specific E3 ubiquitin protein ligase 2; Smad ubiquitination regulatory factor 1; SMAD ubiquitination regulatory factor 2; Smad-specific E3 ubiquitin ligase 1; SMAD-specific E3 ubiquitin-protein ligase 1; SMAD-specific E3 ubiquitin-protein ligase 2; SMURF1; SMURF2
• Common Name: SMURF1
• Gene Symbol: Smurf1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining