Invitrogen™ Human SND1 (aa 484-588) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102051	100 μL

Catalog No. RP102051 Supplier Invitrogen™ Supplier No. RP102051

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SND1/P100 (staphylococcal nuclease and tudor domain containing 1), also known as TudorSN, functions in the Pim-1 regulation of Myb activity and acts as a transcriptional activator of EBNA-2. It also interacts with EAV, NSP1, GTF2E1 and GTF2E2, and forms a ternary complex with Stat6 and POLR2A. The staphylococcal nuclease-like (SN)-domains directly interact with amino acids 1099-1758 of CBP. SND1/P100 plays an important role in the assembly of Stat6 transcriptome and stimulates IL-4-dependent transcription by mediating interaction between Stat6 and CBP.

Specifications

• Accession Number: Q7KZF4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27044
• Name: Human SND1 (aa 484-588) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 100 kDa coactivator; 4SNc-Tudor domain protein; 4SNc-Tudor domain protein long form; 4SNc-Tudor domain protein short form; AL033314; EBNA-2 co-activator (100kD); EBNA2 coactivator p100; p100; p100 co-activator; p100 co-activator variant 1; p100 EBNA2 co-activator; p100L; P100-like protein short variant; p100S; similar to Homo sapiens EBNA-2 co-activator (100kDa coactivator); p105 coactivator; SN4TDR; SND p102; SND1; snd1 protein; SND1-BRAF fusion; staphylococcal nuclease and tudor domain containing 1; staphylococcal nuclease domain containing 1; staphylococcal nuclease domain-containing protein 1; TDRD11; testis tissue sperm-binding protein Li 82P; tudor domain-containing protein 11; TudorSN; Tudor-SN; wu:fc27g10
• Common Name: SND1
• Gene Symbol: Snd1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining