Invitrogen™ Human SNIP1 (aa 123-198) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94439	100 μL

Catalog No. RP94439 Supplier Invitrogen™ Supplier No. RP94439

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57864. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression.

Specifications

• Accession Number: Q8TAD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 79753
• Name: Human SNIP1 (aa 123-198) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410133M08Rik; dJ423B22.2; FHA domain-containing protein SNIP1; PMRED; RP3-423B22.3; Smad nuclear interacting protein; smad nuclear interacting protein 1; Smad nuclear interacting protein 1 Snip1; smad nuclear-interacting protein 1; Snip1
• Common Name: SNIP1
• Gene Symbol: SNIP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining