Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human SnoN (aa 310-448) Control Fragment Recombinant Protein

Catalog No. RP89553
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89553 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89553 Supplier Invitrogen™ Supplier No. RP89553
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TGF-beta is a ubiquitously expressed cytokine that signals through the Smad protein family to regulate numerous cellular processes such as embryonic development and tumorigenesis. This signaling is negatively regulated by Ski, the mammalian homolog of the transforming protein of an avian retrovirus that induces oncogenic transformation of chicken embryo cells, and the related protein SnoN. Like Ski, SnoN functions by binding to the Smad proteins and preventing their phosphorylation, thereby inhibiting their ability to bind DNA and activate the transcription of downstream genes. SnoN is located primarily in the nucleus in cancer tissues or cells, but in the cytoplasm in normal tissues or primary epithelial cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P12757
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6498
Name Human SnoN (aa 310-448) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias EGK_11909; LOW QUALITY PROTEIN: ski-like protein; SKI like proto-oncogene; ski/sno related; SKIL; SKI-like; SKI-like oncogene; ski-like protein; ski-like protein-like; SKI-like proto-oncogene; Skir; ski-related oncogene; ski-related oncogene snoN; Ski-related protein; SNO; SnoA; SnoI; SnoN; v-ski sarcoma viral oncogene homolog
Common Name SnoN
Gene Symbol SKIL
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.