Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89962747

Abnova™ Human SNRPF (P46778) Full-length Recombinant Protein expressed in yeast

Catalog No. 89962747 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-962-747 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-962-747 Supplier Abnova™ Supplier No. P3773
Only null left
Add to Cart
Add to Cart

Description

Used for SDS-PAGE

Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Specifications

Accession Number P46778
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 6636
Molecular Weight (g/mol) 9.714kDa
Name SNRPF (Human) Recombinant Protein
Preparation Method Yeast expression system
Purification Method Affinity Purification
Quantity 100 μg
Immunogen MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Storage Requirements Store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias SMF
Common Name SNRPF
Gene Symbol SNRPF
Species Yeast
Recombinant Recombinant
Protein Tag None
Expression System Yeast expression system
Form Liquid
Purity or Quality Grade 0.9
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.