Invitrogen™ Human SPECC1L (aa 884-940) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104118	100 μL

Catalog No. RP104118 Supplier Invitrogen™ Supplier No. RP104118

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64448. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. Transcripts ranging in size from 4. 8 to 7. 0 kb which result from alternative polyadenylation have been reported for this gene.

Specifications

• Accession Number: Q69YQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23384
• Name: Human SPECC1L (aa 884-940) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930470P14Rik; 4932439K10Rik; 9530057A13Rik; AI317249; cytokinesis and spindle organization A; cytospin A; cytospin-A; CYTSA; GBBB2; Kiaa0376; mKIAA0376; OBLFC1; Renal carcinoma antigen NY-REN-22; RGD1309570; Specc1l; SPECC1-like; SPECC1-like protein; sperm antigen with calponin homology and coiled-coil domains 1 like; sperm antigen with calponin homology and coiled-coil domains 1-like
• Common Name: SPECC1L
• Gene Symbol: SPECC1L
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining