Invitrogen™ Human SPRED1 (aa 35-87) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105211	100 μL

Catalog No. RP105211 Supplier Invitrogen™ Supplier No. RP105211

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84518. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras-MAP kinase pathway is essential for the differentiation of neuronal cells and myocytes; it is inhibited by Spred1, a member of the Sprouty family of proteins. Spred1 acts by suppressing the phosphorylation and activation of Raf. The Spred proteins have also been implicated in the negative feedback regulation of FGF signaling in embryogenesis and angiogenesis. Further studies have shown that expression levels of Spred1 and Spred2 proteins are inversely correlated with the incidence of tumor invasion and metastasis in human hepatocellular carcinoma (HHC), suggesting that these proteins could be useful as prognostic factors and therapeutic targets in HCC. Defects in this gene are a cause of neurofibromatosis type 1-like syndrome (NFLS).

Specifications

• Accession Number: Q7Z699
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 161742
• Name: Human SPRED1 (aa 35-87) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730461F13Rik; AL024345; AW047647; hSpred1; NFLS; PPP1R147; protein phosphatase 1, regulatory subunit 147; SPRED1; spred-1; sprouty protein with EVH-1 domain 1, related sequence; sprouty related EVH1 domain containing 1; sprouty related, EVH1 domain containing 1; sprouty-related protein 1 with EVH-1 domain; sprouty-related, EVH1 domain containing 1; sprouty-related, EVH1 domain-containing protein 1; suppressor of Ras/MAPK activation
• Common Name: SPRED1
• Gene Symbol: SPRED1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining