Invitrogen™ Human SPRY1 (aa 141-189) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105507	100 μL

Catalog No. RP105507 Supplier Invitrogen™ Supplier No. RP105507

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67111. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sprouty-1 and -2 are membrane-anchored phosphoprotein inhibitors of growth factor signaling in endothelial cells. Four mammalian Sprouty homologues (Sprouty-1-4) have been identified. One study showed that overexpressed Sprouty-1 and -2 inhibits fibroblast growth factor and vascular endothelial growth factor-induced proliferation and differentiation by repressing pathways leading to MAP kinase activation. Sprouty proteins are also endogenous inhibitors of the Ras/MAP kinase pathway that play an important role in the remodeling of branching tissues, such as in development of the lung, kidney tubules, vascular system, and breast ducts. A recent study shows that Sprouty-1 and -2 may have tumor suppressing activity in the breast, and found that both proteins are consistently down-regulated in breast carcinomas.

Specifications

• Accession Number: O43609
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10252
• Name: Human SPRY1 (aa 141-189) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: hSPRY1; Protein sprouty homolog 1; sprouty 1; sprouty homolog 1 (Drosophila); sprouty homolog 1, antagonist of FGF signaling; sprouty homolog 1, antagonist of FGF signaling (Drosophila); sprouty RTK signaling antagonist 1; sprouty, Drosophila, homolog of, 1 (antagonist of FGF signaling); sprouty1; SPRY1; spry-1
• Common Name: SPRY1
• Gene Symbol: SPRY1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining