Invitrogen™ Human SPTBN1 (aa 1506-1613) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89904	100 μL

Catalog No. RP89904 Supplier Invitrogen™ Supplier No. RP89904

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin (Sp), the most abundant of the erythrocyte membrane skeleton proteins, helps these cells maintain their characteristic biconcave shape while remaining flexible and elastic. Erythrocyte Sp is a heterodimer composed of a 280 kDa alpha subunit and a 246 kDa beta subunit which associate in a side-to-side, antiparallel configuration to form a 100 nm rod-like structure. Sp in other tissues may be composed of distinct but homologous alpha and beta subunits, sometimes referred to as fodrin. A newly introduced nomenclature designates the Sp subunits of the erythrocyte as alpha-1 and beta-1, and the fodrin subunits as alpha-2 and beta-2. Alternatively spliced forms of each are designated as epsilon-1, epsilon-2, etc. (e. g. beta-1 epsilon-1).

Specifications

• Accession Number: Q01082
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6711
• Name: Human SPTBN1 (aa 1506-1613) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9930031C03Rik; A2a; a--fodrin; AI842465; AL033301; alpha II spectrin; alpha-fodrin; alpha-II spectrin; alpha-spectrin 2; beta fodrin; beta II spectrin-like (short form); beta-fodrin; beta-G spectrin; beta-I spectrin; Beta-II spectrin; beta-spectrin 1; beta-spectrin 2; beta-spectrin 2, non-erythrocytic; beta-spectrin II; beta-spectrin non-erythrocytic 1; betaSpII; brain alpha-spectrin; brain erythroid spectrin (235E); brain spectrin; bSPII-; cytoskeleton protein; D330027P03Rik; EL3; ELF; elf1; elf3; embryonic liver beta-fodrin; embryonic liver fodrin; embryonic liver fodrin beta chain; epididymis luminal protein 102; erythroid spectrin beta; fodrin alpha chain; Fodrin beta chain; Gm1301; HEL102; HS2; HSPTB1; inhibitory protein factor; IPF; ja; jaundiced; membrane cytoskeletal protein; mKIAA4049; mKIAA4219; noerythroid alpha-spectrin 2; non-erythrocytic; nonerythroid alpha-spectrin 2; non-erythroid spectrin beta; short form of beta II spectrin; Sp beta; spectrin alpha chain, brain; spectrin alpha chain, non-erythrocytic 1; spectrin beta 1; spectrin beta 2; spectrin beta chain, brain 1; spectrin beta chain, erythrocyte; spectrin beta chain, erythrocytic; Spectrin beta chain, non-erythrocytic 1; spectrin beta Tandil; spectrin beta, erythrocytic; spectrin beta, non-erythrocytic 1; spectrin G; spectrin R; spectrin, alpha, non-erythrocytic 1; spectrin, beta, erythrocytic; spectrin, beta, non-erythrocytic 1; spectrin, non-erythroid alpha chain; spectrin, non-erythroid beta chain 1; SPH2; Spna2; Spnb1; Spnb-1; Spnb2; Spnb-2; Spta2; Sptan1; SPTB; SPTB1; Sptb2; Sptbn1
• Common Name: SPTBN1
• Gene Symbol: SPTBN1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining