Invitrogen™ Human SPTLC2 (aa 177-227) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109905	100 μL

Catalog No. RP109905 Supplier Invitrogen™ Supplier No. RP109905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145097. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serine palmitoyltransferase (SPT), which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPT2 is the long chain base subunit 2 of mammalian serine palmitoyltransferase. SPT2 is catalytically active but needs its related protein SPT1 for its stabilization and anchoring the holoenzyme to the cytosolic face of the endoplasmic reticulum. As in the case with SPT1, mutations in the SPT2 gene can cause hereditary sensory and autonomic neuropathy type I (HSAN-I), resulting from a loss of SPT activity as well as the accumulation of the atypical and neurotoxic sphingoid metabolite 1-deoxy-sphinganine.

Specifications

• Accession Number: O15270
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9517
• Name: Human SPTLC2 (aa 177-227) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI173915; hLCB2a; HSN1C; KIAA0526; LCB 2; LCB2; LCB2a; long chain base biosynthesis protein 2; Long chain base biosynthesis protein 2a; mKIAA0526; NSAN1C; Pomt2; protein-O-mannosyltransferase 2; serine palmitoyltransferase 2; serine palmitoyltransferase long chain base subunit 2; serine palmitoyltransferase, long chain base subunit 2; serine palmitoyltransferase, subunit II; serine-palmitoyl-CoA transferase 2; SPT 2; SPT2; Sptlc2
• Common Name: SPTLC2
• Gene Symbol: SPTLC2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining