Invitrogen™ Human SQRDL (aa 141-279) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89841	100 μL

Catalog No. RP89841 Supplier Invitrogen™ Supplier No. RP89841

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59637. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SQRDL (Sulfide: quinone oxidoreductase, mitochondrial) catalyzes the oxidation of hydrogen sulfide, with the help of a quinone. Although the SQRDL precursor protein displays a molecular weight of 50 kDa, a prominent band at about 46 kDa is detected by western blot. This discrepancy reflects the cleavage of an N-terminal targeting sequence of 4 kDa during the import of the protein into the mitochondria. SQRDL is one of the enzymes involved in H2S signaling in a discrete population of neurons, oligodendrocytes, and endothelial cells.

Specifications

• Accession Number: Q9Y6N5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 58472
• Name: Human SQRDL (aa 141-279) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610039J17Rik; 4930557M22Rik; Cc2-17; CGI-44; flavo-binding protein; PRO1975; SQOR; Sqrdl; sulfide dehydrogenase like; Sulfide dehydrogenase-like; Sulfide quinone oxidoreductase; sulfide quinone reductase-like (yeast); sulfide:quinone oxidoreductase, mitochondrial
• Common Name: SQRDL
• Gene Symbol: Sqor
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining