Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human SR-BI Control Fragment Recombinant Protein

Catalog No. RP104112
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104112 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104112 Supplier Invitrogen™ Supplier No. RP104112
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

High density lipoproteins (HDLs) play a critical role in cholesterol metabolism and their plasma concentrations are inversely correlated with risk for atherosclerosis. The SR-BI binds HDLs and mediates selective uptake of HDL cholesteryl ester. SR-BI binds HDL with high affinity, is expressed primarily in liver and nonplacental steroidgenic tissues, and mediates selective cholesterol uptake by a distinct mechanism. In mice, it seems that SR-BI plays a key role in determining the levels of plasma lipoprotein cholesterol and the accumulation of cholesterol stores in the adrenal gland.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WTV0
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 949
Name Human SR-BI Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI120173; CD36; CD36 and LIMPII analogous 1; CD36 antigen (collagen type I receptor thrombospondin receptor)-like 1 (scavanger receptor class B type 1); CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1; CD36 antigen (collagen type I receptor, thrombospondin receptor-like 1); CD36 antigen-like 1; Cd36l1; CD36-related class B scavenger receptor haSR-BI; CLA1; Cla-1; Collagen type I receptor, thrombospondin receptor-like 1; D5Ertd460e; haSR-bI; HDL QTL 1; Hdlq1; HDLQTL6; high density lipoprotein receptor; Hlb398; mSR-BI; Scarb1; scavanger receptor class B type 1; scavenger receptor b1; scavenger receptor class B member 1; scavenger receptor class B type I; scavenger receptor class B type II; scavenger receptor class B type III; scavenger receptor class B, member 1; scavenger receptor class B1; SRB1; SR-B1; SRBI; SR-BI; SR-BII
Common Name SR-BI
Gene Symbol SCARB1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.