Invitrogen™ Human SRC (aa 1-43) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102576	100 μL

Catalog No. RP102576 Supplier Invitrogen™ Supplier No. RP102576

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SRC is a cytoplasmic tyrosine kinase and proto-oncogene involved in the regulation of embryonic development and cell growth. SRC is involved in the regulation of growth and differentiation of eukaryotic cells. SRC associates with the cytoplasmic region of various cell surface receptors to facilitate signal transduction, and is also involved in cytoskeletal organization, cell cycle regulation, and apoptosis. In humans, the gene encoding SRC is present on chromosome 20. Activity of SRC is regulated by two tyrosine residues (Tyr 416 and Tyr527), and phosphorylation of these two sites have opposing effects. Phosphorylation of Tyr416 in the activation loop of the kinase domain upregulates enzyme activity while the phosphorylation of Tyr527 decreases enzyme activity. Mutations in the SRC gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same SRC protein have been found thus far.

Specifications

• Accession Number: P12931
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6714
• Name: Human SRC (aa 1-43) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ASV; AW259666; csrc; c-SRC; c-src protein, C terminus; EC 2.7.10.2; fc54g04; Neuronal proto-oncogene tyrosine-protein kinase Src; non-tyrosine protein kinase; ORF; OTTHUMP00000174476; OTTHUMP00000174477; OTTHUMP00000174478; p60-Src; p60-Src-1; PP60C-SCR; pp60c-src; pp60src; pp60v-src; protein-tyrosine kinase; proto-oncogene c-Src; protooncogene SRC, Rous sarcoma; Proto-oncogene tyrosine-protein kinase Src; Rous sarcoma oncogene; RP5-823N20.1; sb:cb864; SDR; src; src downstream region; src oncogene; SRC proto-oncogene, non-receptor tyrosine kinase; SRC proto-oncogene, non-receptor tyrosine kinase L homeolog; SRC proto-oncogene, non-receptor tyrosine kinase S homeolog; src.L; src.S; SRC1; src-1; src1-A; src-a; src-b; THC6; transforming protein; tyrosine kinase pp60c-src; tyrosine protein kinase c-src; tyrosine protein kinase pp60-c-src; tyrosine-protein kinase SRC-1; Unknown; v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog; v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog; v-src sarcoma viral oncogene; wu:fc54g04; XELAEV_18046582mg; xsrc
• Common Name: SRC
• Gene Symbol: SRC
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining