Invitrogen™ Human SSH2 (aa 1008-1101) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103721	100 μL

Catalog No. RP103721 Supplier Invitrogen™ Supplier No. RP103721

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63402. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SSH2 (slingshot homolog 2) is a 1,423 amino acid protein that localizes to both the cytoplasm and the cytoskeleton and is a human homolog of the Drosophila slingshot (ssh) protein. Containing one tyrosine-protein phosphatase domain, SSH2 functions as a protein phosphatase that regulates Actin filament dynamics via the dephosphorylation of target proteins, such as Cofilin, which mediate Actin filament assembly and disassembly. Four isoforms of SSH2 exist due to alternative splicing events. The gene encoding SSH2 maps to human chromosome 17, which comprises over 2.5% of the human genome and encodes over 1,200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Malfunction or loss of p53 expression is associated with malignant cell growth and Li-Fraumeni syndrome.

Specifications

• Accession Number: Q76I76
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 85464
• Name: Human SSH2 (aa 1008-1101) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: hSSH-2L; KIAA1725; mSSH-2L; Protein phosphatase Slingshot homolog 2; slingshot 2L; slingshot homolog 2; slingshot homolog 2 (Drosophila); slingshot protein phosphatase 2; slingshot-like 2; Ssh2; SSH-2; Ssh2l; SSH-2L; SSH-like protein 2
• Common Name: SSH2
• Gene Symbol: SSH2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVEIIEYTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining