Invitrogen™ Human SSTR4 (aa 347-388) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103554	100 μL

Catalog No. RP103554 Supplier Invitrogen™ Supplier No. RP103554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified.

Specifications

• Accession Number: P31391
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6754
• Name: Human SSTR4 (aa 347-388) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: G-protein coupled receptor; Smstr4; somatostatin receptor; somatostatin receptor 4; Somatostatin receptor subtype 4 Rattus norvegicus Sprague-Dawley major hippocampal somatostatin receptor (SSTR4) mRNA; somatostatin receptor type 4; SS4R; SS-4-R; SS4-R; sst4; Sstr4
• Common Name: SSTR4
• Gene Symbol: SSTR4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining