Invitrogen™ Human ST2 (aa 406-551) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90129	100 μL

Catalog No. RP90129 Supplier Invitrogen™ Supplier No. RP90129

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110727. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL-33R, also known as ST2, is a receptor for IL-33. It is a member of the IL-1 receptor family of innate receptors. Its extracellular domain consists of 3 Ig-like domains that directly interact with its co-receptor IL-1RAcP, and the ligand alarmin, IL-33. IL-33 ligation results in the association of IL-33R complex with its adaptor proteins MyD88, IRAK1, IRAK4 and TRAF6, and activation of the NF-kB, and MAPK pathways. This, in turn, instigates the release of chemokines and cytokines such as IL-5, IL-6, IL-8, and IL-13. Two most common isoforms of IL-33R that result from alternative splicing are ST2L - the membrane bound form, and ST2S - the soluble form. The membrane bound form can be released from the cell surface by proteolytic cleavage. The soluble forms have been suggested to act as decoys dampening the IL-33 signaling. IL-33R is primarily expressed by mast cells, basophils, and eosinophils. In mouse, IL-33R expression has been shown on ILC2 and Th2 cells. IL-33R signaling has been implicated in the number of immune conditions, including allergies, arthritis, atherosclerosis and sepsis.

Specifications

• Accession Number: Q01638
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9173
• Name: Human ST2 (aa 406-551) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DER4; Fit1; Fit-1; Fos-responsive gene 1 protein; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; IL-1 R4; IL1RL1; IL-1RL1; IL33R; IL-33R; interleukin 1 receptor like 1; interleukin 1 receptor-like 1; interleukin 1 receptor-related protein; Interleukin1 receptor like 1; interleukin-1 receptor-like 1; Interleukin-33 receptor alpha chain; Ly84; lymphocyte antigen 84; Protein ST2; Protein T1; sIL 33R; soluble IL 33 Receptor; soluble IL 33R; St2; ST2L; St2-rs1; ST2V; Ste2; T1; T1/ST2
• Common Name: ST2
• Gene Symbol: IL1RL1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining