Invitrogen™ Human ST3GAL6 (aa 42-148) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89966	100 μL

Catalog No. RP89966 Supplier Invitrogen™ Supplier No. RP89966

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53845. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sialyltransferases catalyze the transfer of sialic acid from cytidine 5-prime monophospho-N-acetylneuraminic acid (CMP-NeuAc) to terminal positions of glycoprotein and glycolipid carbohydrate groups. Terminal NeuAc residues are key determinants of carbohydrate structures, such as the sialyl-Lewis X determinants, and are widely distributed in many cell types. However, cancer cells often express more heavily sialylated glycans on their cell surface and this feature sometimes correlates with invasiveness. In contrast, expression of ST3gal6, a member of the sialyltransferase family that sialylates type II lactosamine structures on glycoproteins and glycolipids, was found to be significantly decreased by hypermethylation of the gene in gastrointestinal cancer. At least three isoforms of ST3gal6 are known to exist.

Specifications

• Accession Number: Q9Y274
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10402
• Name: Human ST3GAL6 (aa 42-148) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1700023B24Rik; AI930218; alpha2,3-sialyltransferase ST3Gal VI; alpha-2,3-sialyltransferase VI; AW552396; CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; sia10; Sialyltransferase 10; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); SIAT10; ST3 beta-galactoside alpha-2,3-sialyltransferase 6; ST3Gal VI; ST3GAL6; ST3GalVI; type 2 lactosamine alpha-2,3-sialyltransferase
• Common Name: ST3GAL6
• Gene Symbol: ST3GAL6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining