Invitrogen™ Human STAM (aa 111-170) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102948	100 μL

Catalog No. RP102948 Supplier Invitrogen™ Supplier No. RP102948

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83687. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STAM (Signal transducing adaptor molecule) is an adaptor molecule involved in downstream signaling pathways mediated by growth factors and cytokines. STAM also plays an important role in endocytosis, the JAK-STAT signaling pathway, and membrane trafficking. In humans, the gene encoding STAM is located on chromosome 10.

Specifications

• Accession Number: Q92783
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8027
• Name: Human STAM (aa 111-170) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DKFZp686J2352; HSE1 homolog; RGD1564499; signal transducing adapter molecule 1; signal transducing adaptor molecule; signal transducing adaptor molecule (SH3 domain and ITAM motif) 1; Stam; STAM1; STAM-1; STAT91
• Common Name: STAM
• Gene Symbol: STAM
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining