Invitrogen™ Human STEP (aa 390-454) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107861	100 μL

Catalog No. RP107861 Supplier Invitrogen™ Supplier No. RP107861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111688. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reversible phosphorylation of tyrosine residues is a key regulatory mechanism for numerous cellular events such as proliferation, differentiation, gene expression and migration. Abnormalities in tyrosine phosphorylation play a role in the pathogenesis of numerous inherited or acquired human diseases from cancer to immune deficiencies. There are at least 107 genes coding for PTPs (protein tyrosine phosphatases) in the human genome. All known PTPs contain a highly conserved 12 amino acid catalytic domain and are further distinguished on the basis of additional structural motifs. The receptor-like PTPs exhibit an extracellular domain, a single transmembrane and one or two intracellular phosphatase domains. The nonreceptor cytoplasmic PTPs contain a single phosphatase domain and additional amino acid sequences that are homologous to motifs found in other classes of proteins. Protein tyrosine phosphatases PTPN5 (STEP), PTPRR and PTPN7 comprise a family of phosphatases that specifically inactivate MAPKs (mitogen-activated protein kinases). There are multiple forms of STEP in the adult rat brain which show differential enrichment in brain regions implicated in aspects of cognitive, affective, and motor behaviors. Some of the STEP isoforms are generated through alternative splicing of a single STEP gene and each has unique intracellular targets and functions.

Specifications

• Accession Number: P54829
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84867
• Name: Human STEP (aa 390-454) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: FLJ14427; Neural-specific protein-tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 5; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched); protein-tyrosine phosphatase striatum-enriched; protein-tyrosine-phosphatase non-receptor 5; PTN5; PTP STEP; PTPN 5; PTPN5; PTPSTEP; STEP; STEP61; striatal-enriched protein tyrosine phosphatase; striatum-enriched protein-tyrosine phosphatase; Tyrosine-protein phosphatase non-receptor type 5
• Common Name: STEP
• Gene Symbol: PTPN5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining