Invitrogen™ Human STING Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96974	100 μL

Catalog No. RP96974 Supplier Invitrogen™ Supplier No. RP96974

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STING is a 379 amino acid containing signaling protein that acts as an important component of innate immune signaling. This signaling protein is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. STING may have translocon function, the translocon possibly being able to influence the induction of type I interferons and is also involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) thus facilitating the detection of intracellular viral RNA species as well as B-form DNA and mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Generally seen in endoplasmic reticulum membrane, cell membrane and mitochondrion outer membrane, it is ubiquitously expressed in most of tissues.

Specifications

• Accession Number: Q86WV6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 340061
• Name: Human STING Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610307O08Rik; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; ERIS; hMITA; hSTING; hypothetical LOC533661; mediator of IRF3 activation; Mita; mitochondrial mediator of IRF3 activation; mitochondrial transmembrane protein 173; MMITA; Mpys; mSTING; NET23; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; poSTING; RGD1562552; rSTING; SAVI; Stimulator of interferon genes protein; stimulator of interferon response cGAMP interactor 1; STING; STING1; tm173; Tmem173; Transmembrane protein 173
• Common Name: STING
• Gene Symbol: TMEM173
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining