Invitrogen™ Human STRIP2 (aa 283-358) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92712	100 μL

Catalog No. RP92712 missing translation for 'mfr' Invitrogen™ missing translation for 'supplierNo' RP92712

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [UniProt].

Specifications

• Accession Number: Q9ULQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57464
• Name: Human STRIP2 (aa 283-358) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D330017J20Rik; FAM40B; family with sequence similarity 40, member B; FAR11 factor arrest 11 homolog B; FAR11B; homolog of yeast FAR11 protein 2; Kiaa1170; Protein FAM40B; striatin interacting protein 2; striatin-interacting protein 2; Striatin-interacting proteins 2; STRIP2; Stripb
• Common Name: STRIP2
• Gene Symbol: STRIP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining