Invitrogen™ Human STUB1 (aa 232-303) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98669	100 μL

Catalog No. RP98669 Supplier Invitrogen™ Supplier No. RP98669

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A recently identified protein, termed carboxyl terminus of hsc70-interacting protein (CHIP), has been shown to interact both with the constitutive form of hsc70 and the stress inducible form, hsp70. This novel 35 kDa cytoplasmic protein has been shown to be highly expressed in striated muscle in vivo. Additional studies have shown that this protein is expressed over a broad range of cultured tissues. Through immunoprecipitation experiments, CHIP has been shown to directly bind to the carboxyl terminus of hsc70 and hsp70 where it decreases ATPase activity and reduces overall chaperone efficiency. CHIP has also been identified as an important protein in the ubiquitin-proteasome system. CHIP contains a U-box domain and acts as an E3 ubiquitin-ligase in conjunction with hsc70 and hsp90.

Specifications

• Accession Number: Q9UNE7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10273
• Name: Human STUB1 (aa 232-303) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610033N24Rik; 2210017D18Rik; 2310040B03Rik; Antigen NY-CO-7; AW046544; Carboxy terminus of Hsp70-interacting protein; CHIP; CLL-associated antigen KW-8; E3 ubiquitin-protein ligase CHIP; heat shock protein A binding protein 2 (c-terminal); HSPABP2; LA16c-313D11.6; NY-CO-7; PP1131; RING-type E3 ubiquitin transferase CHIP; SCAR16; SDCCAG7; serologically defined colon cancer antigen 7; STIP1 homology and U box-containing protein 1; STIP1 homology and U-box containing protein 1; STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase; Stub1; UBOX1
• Common Name: STUB1
• Gene Symbol: STUB1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining