Invitrogen™ Human STX16 (aa 149-216) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98448	100 μL

Catalog No. RP98448 Supplier Invitrogen™ Supplier No. RP98448

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59833. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O14662
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8675
• Name: Human STX16 (aa 149-216) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930401D03; 5430410K23Rik; 6330500A18Rik; AI648908; AW553605; CG1467; CG1467-PA; Dm Syx16; Dmel\CG1467; Dmel_CG1467; DmSyx16; dSyntaxin16; dSyx 16; dSyx16; MGC90328; RP11-261P9.3; STX16; Syn16; syntaxin; syntaxin 16; Syntaxin16; syntaxin-16; Syx; SYX16; Syx16-PA
• Common Name: STX16
• Gene Symbol: STX16
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining