Invitrogen™ Human Synaptophysin (aa 263-313) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110119	100 μL

Catalog No. RP110119 Supplier Invitrogen™ Supplier No. RP110119

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synaptophysin is a calcium-binding and integral membrane glycoprotein present in presynaptic vesicles in almost all neurons. Synaptophysin has four transmembrane domains and it forms a complex with dynamin at high calcium concentrations suggesting an involvement in synaptic vesicle endocytosis. It is also involved in the regulation of short-term and long-term synaptic plasticity. Synaptophysin is currently the most widely used marker for nerve terminals and for differentiating neuroendocrine tumors. Mutations in the gene can result in mental retardation, X-linked 96.

Specifications

• Accession Number: P08247
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6855
• Name: Human Synaptophysin (aa 263-313) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A230093K24Rik; AI848995; BM89 antigen; I79_012252; Major synaptic vesicle protein p38; MRX96; MRXSYP; p38; Syn; Synaptophysin; Syp; Syp I; Syp1
• Common Name: Synaptophysin
• Gene Symbol: Syp
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining