Invitrogen™ Human Syncollin Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99213	100 μL

Catalog No. RP99213 Supplier Invitrogen™ Supplier No. RP99213

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syncollin is a 134 amino acid, small peripheral membrane protein abundantly expressed in pancreatic acinar cells and is tightly associated with the lumenal side of the zymogen granule membrane. It contains intrachain disulfide bonds. Syncollin is also known to associate with lipid rafts in a cholesterol-dependent manner. In pancreatic acinar cells, syncollin helps in exocytosis and also plays a role in maturation and/or concentration of zymogens in zymogen granules. Reports suggest that syncollin may also have a pore-forming activity on membranes and regulate exocytosis insome exocrine tissues.

Specifications

• Accession Number: Q0VAF6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 342898
• Name: Human Syncollin Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0910001K16Rik; 1810038B08Rik; FLJ27441; INSSA1; insulin synthesis associated 1; insulin synthesis-associated protein 1; Proximal small intestine-specific protein 9; Sip9; Sycn; SYL; syncollin
• Common Name: Syncollin
• Gene Symbol: SYCN
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining