Invitrogen™ Human SYNGR3 (aa 166-227) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99856	100 μL

Catalog No. RP99856 Supplier Invitrogen™ Supplier No. RP99856

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60146. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synaptogyrins comprise a family of tyrosine-phosphorylated membrane proteins with two neuronal (SYNGR1 and SYNGR3) and one ubiquitous (SYNGR2) members. SYNGR1 and -3 are synaptic vesicle proteins, residing in some cases on the same synaptic vesicle, and are thought to be involved in the regulation of neurotransmitter release. SYNGR2, by contrast, is absent from synaptic vesicles. The role and localization of a fourth synaptogyrin, SYNGR4, is unclear. SYNGR3 is predominantly expressed in brain and placenta. SYNGR3 is involved in the positive regulation of dopamine transporter activity and facilitates the physical and functional interactions of the transporter with the dopamine vesicular storage system, allowing a more efficient loading of the vesicles with extracellular dopamine after release.

Specifications

• Accession Number: O43761
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9143
• Name: Human SYNGR3 (aa 166-227) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Sgyr III; synaptogryin III; synaptogyrin 3; synaptogyrin-3; Syngr3
• Common Name: SYNGR3
• Gene Symbol: SYNGR3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining