Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human TAB2 (aa 232-301) Control Fragment Recombinant Protein

Catalog No. RP108562
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108562 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108562 Supplier Invitrogen™ Supplier No. RP108562
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAB2 is an activator of MAP3K7/TAK1, which is required for the IL-1 induced activation NF-kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serves as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKL through the activation of the receptor activator of NF-kappaB (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts. Recent experiments have shown that TAB2 and the related protein TAB3 constitutively interact with the autophagy mediator Beclin-1; upon induction of autophagy, these proteins dissociate from Beclin-1 and bind TAK1. Overexpression of TAB2 and TAB3 inhibit autophagy, while their depletion triggers it, suggesting that TAB2 and TAB3 act as a control point for autophagy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYJ8
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 23118
Name Human TAB2 (aa 232-301) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1110030N06Rik; A530078N03Rik; CHTD2; FLJ21885; KIAA0733; MAP3K7IP2; mitogen activated protein kinase kinase kinase 7 interacting protein 2; mitogen-activated protein kinase kinase kinase 7 interacting protein 2; mitogen-activated protein kinase kinase kinase 7-interacting protein 2; mKIAA0733; OTTHUMP00000017388; Tab2; TAB-2; Tak1 binding protein 2; TAK1-binding protein 2; TGF-beta activated kinase 1 (MAP3K7) binding protein 2; TGF-beta activated kinase 1/MAP3K7 binding protein 2; TGF-beta-activated kinase 1 and MAP3K7-binding protein 2; TGF-beta-activated kinase 1-binding protein 2
Common Name TAB2
Gene Symbol Tab2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.