Invitrogen™ Human TAB2 (aa 601-670) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108510	100 μL

Catalog No. RP108510 Supplier Invitrogen™ Supplier No. RP108510

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAB2 is an activator of MAP3K7/TAK1, which is required for the IL-1 induced activation NF-kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serves as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKL through the activation of the receptor activator of NF-kappaB (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts. Recent experiments have shown that TAB2 and the related protein TAB3 constitutively interact with the autophagy mediator Beclin-1; upon induction of autophagy, these proteins dissociate from Beclin-1 and bind TAK1. Overexpression of TAB2 and TAB3 inhibit autophagy, while their depletion triggers it, suggesting that TAB2 and TAB3 act as a control point for autophagy.

Specifications

• Accession Number: Q9NYJ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23118
• Name: Human TAB2 (aa 601-670) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110030N06Rik; A530078N03Rik; CHTD2; FLJ21885; KIAA0733; MAP3K7IP2; mitogen activated protein kinase kinase kinase 7 interacting protein 2; mitogen-activated protein kinase kinase kinase 7 interacting protein 2; mitogen-activated protein kinase kinase kinase 7-interacting protein 2; mKIAA0733; OTTHUMP00000017388; Tab2; TAB-2; Tak1 binding protein 2; TAK1-binding protein 2; TGF-beta activated kinase 1 (MAP3K7) binding protein 2; TGF-beta activated kinase 1/MAP3K7 binding protein 2; TGF-beta-activated kinase 1 and MAP3K7-binding protein 2; TGF-beta-activated kinase 1-binding protein 2
• Common Name: TAB2
• Gene Symbol: Tab2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining