Invitrogen™ Human TAC1 (aa 31-129) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90655	100 μL

Catalog No. RP90655 Supplier Invitrogen™ Supplier No. RP90655

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110792. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P20366
• Concentration: 4.80 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6863
• Name: Human TAC1 (aa 31-129) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930528L02Rik; C-terminal-flanking peptide; Hs.2563; neurokinin 1; neurokinin 2; neurokinin A; neurokinin alpha; neuromedin L; Neuropeptide gamma; neuropeptide K; NK1; NK-1; NK2; NKA; NKNA; NPK; PPT; Ppt5fl; PPTA; PPT-A; PPTA3; preprotachykinin; preprotachykinin A; protachykinin; protachykinin-1; RATPPTA3; SP; substance K; Substance P; TAC; Tac1; Tac2; Tachykinin (substance P, neurokinin A, neuropeptide K, neuropeptide gamma); tachykinin 1; tachykinin 2; tachykinin precursor 1; tachykinin, precursor 1; tachykinin, precursor 1 (substance K, substance P, neurokinin 1, neurokinin 2, neuromedin L, neurokinin alpha, neuropeptide K, neuropeptide gamma)
• Common Name: TAC1
• Gene Symbol: TAC1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining