Invitrogen™ Human TADA2L (aa 1-67) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108086	100 μL

Catalog No. RP108086 Supplier Invitrogen™ Supplier No. RP108086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67425. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TADA2L (transcriptional adapter 2-like), also known as TADA2A (transcriptional adapter 2-alpha) or ADA2-like protein, is a 443 amino acid nuclear protein that exists as 2 alternatively spliced isoforms. While most abundantly expressed in testis, TADA2L is present in all tissues. TADA2L contains one SANT domain and one SWIRM domain, and interacts with GCN5 and GR (NR3C1). Its ability to bind double-stranded DNA allows TADA2L to play a role in chromatin remodeling. Although it makes up part of the PCAF complex, TADA2L is also a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. The gene that encodes TADA2L contains 71,408 bases and maps to human chromosome 17q12. Chromosome 7 houses over 1,000 genes, comprises nearly 5% of the human genome and has been linked to osteogenesis imperfecta, Pendred syndrome, lissencephaly, citrullinemia and Shwachman-Diamond syndrome.

Specifications

• Accession Number: O75478
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6871
• Name: Human TADA2L (aa 1-67) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ADA2; ADA2A; ADA2-like protein; AV319371; D030022J10Rik; hADA2; KL04P; TADA2A; TADA2L; transcriptional adapter 2-alpha; Transcriptional adapter 2-like; transcriptional adaptor 2 alpha; transcriptional adaptor 2A
• Common Name: TADA2L
• Gene Symbol: TADA2A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining