Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human TAF4B (aa 317-463) Control Fragment Recombinant Protein

Catalog No. RP89354
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89354 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89354 Supplier Invitrogen™ Supplier No. RP89354
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56014. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAF II p105, also called TAF4B, is a celltype specific transcriptional co-activator that is a component of the TFIID complex. Expressed primarily in B cells and ovarian granulosa cells, TAF II p105 can interact with OCBA/POU2AF1 to activate B cell-specific octamerdependent transcription. Additionally, TAF II p105 plays an important role in co-activating the transcription factor NFkB and is essential for activation of anti-apoptotic genes such as TNFAIP3. TAF II p135, also known as TAF4, TAF2C, TAF2C1, TAF4A or TAFII130, is a 1,085 amino acid subunit of TFIID that accelerates transcriptional activation triggered by thyroid hormone (TR) or retinoic acid (RA). Localized to the nucleus, TAF II p135 contains one TAFH domain and is thought to bind to proteins that contain glutamine-rich domains, such as the transcription factor CREB.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92750
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6875
Name Human TAF4B (aa 317-463) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias SPGF13; TAF(II)105; TAF2C2; TAF4B; TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa; TAFII105; TAFII-105; TATA box binding protein (TBP)-associated factor 4B; TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD; TATA box binding protein associated factor 4b; TATA-box binding protein associated factor 4b; transcription initiation factor TFIID 105 kDa subunit; Transcription initiation factor TFIID subunit 4B
Common Name TAF4B
Gene Symbol TAF4B
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.