Invitrogen™ Human TAF5 (aa 172-300) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89362	100 μL

Catalog No. RP89362 Supplier Invitrogen™ Supplier No. RP89362

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TFIID is a general transcription factor which initiates preinitiation complex assembly through direct interaction with the TATA promoter element. It is a multisubunit complex consisting of a small TATA-binding polypeptide andother TATA-binding protein (TBP)-associated factors (TAFs). Although native TFIID can mediate both activator-independent (basal) and activator-dependent transcription in reconstituted systems, TBP can mediate only basal transcription. TAF II p100 (TBP-associated factor II100), also known as TAF5 or TAFII100, is the third largest subunit of human TFIID. It contains six WD40 repeats at the C-terminus and has an N-terminus capable of forming a flexible dimer. TAF II p100 plays an important role in forming the scaffold that is crucial for the assembly of the TFIID complex. TAF II p100 may also be involved in the stabilization of TAF interactions.

Specifications

• Accession Number: Q15542
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6877
• Name: Human TAF5 (aa 172-300) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6330528C20Rik; AV117817; TAF(II)100; TAF2D; TAF5; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa; TAFII100; TAFII-100; TATA box binding protein (TBP)-associated factor 2D; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD; TATA box binding protein associated factor 5; TATA-box binding protein associated factor 5; Tbp-associated factor 5; transcription initiation factor TFIID 100 kD subunit; transcription initiation factor TFIID 100 kDa subunit; Transcription initiation factor TFIID subunit 5
• Common Name: TAF5
• Gene Symbol: TAF5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining