Invitrogen™ Human TAK1 (aa 254-367) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89786	100 μL

Catalog No. RP89786 Supplier Invitrogen™ Supplier No. RP89786

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAK1 (also known as MAP3K7), a part of the serine/threonine kinase family, is a versatile protein with many signaling functions. Originally identified as a TGF- beta-activated kinase, TAK1 interacts with TGF- beta-receptor and TRAF6 to modulate TGF- beta activation of JNK and p38. It has additional roles in activation of p38 and JNK through Wnt, BMP, and activin signaling pathways as well in response to thyroid hormone, osmotic stress, endothelin, and ephrine. Through activation of von Hippel-Lindau tumor suppressor expression, TAK1 represses PDGF-B, integrin beta1 and integrin beta5, promoting proper wound healing. TAK1 also plays an essential role in IKK activation in numerous signaling pathways including IL-1, IL-6, IL-18, TNF, CD40, TLR, and RIG-I. Activation of the TAK1-IKK pathway requires TAB2/3 and ubiquitination. In this process, TAB2/3 binds to the C-terminal region of TAK1 and becomes polyubiquitinated, TAK1 is autophosphorylated at Thr178, Thr184, Thr187 and Ser192, and finally TAK1 phosphorylates IKK- beta. Additionally, TAK1 represses human telomerase reverse transcriptase suggesting a role in regulation of cell lifespan.

Specifications

• Accession Number: O43318
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6885
• Name: Human TAK1 (aa 254-367) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B430101B05; C87327; hypothetical protein LOC553788; I79_000697; M3K7; map3k7; map3k7.L; MAPKKK; MEKK7; mitogen activated protein kinase kinase kinase 7; mitogen-activated protein kinase kinase kinase 7; mitogen-activated protein kinase kinase kinase 7 L homeolog; RP1-154G14.1; si:ch211-225h9.1; Tak1; TAK1z; TGF1a; TGF-beta activated kinase 1; TGF-beta-activated kinase 1; TGF-beta-activated kinase TAK1; transforming growth factor beta-activated kinase 1; transforming growth factor-beta-activated kinase 1; XELAEV_18027270mg; xTAK1; zgc:110612
• Common Name: TAK1
• Gene Symbol: MAP3K7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining