Invitrogen™ Human TANK (aa 7-90) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102779	100 μL

Catalog No. RP102779 Supplier Invitrogen™ Supplier No. RP102779

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TANK was initially identified as a novel TRAF-interacting protein that regulated TRAF-mediated signal transduction. Specifically, ligand binding by surface receptors in the tumor necrosis factor (TNF) receptor and Toll/interleukin-1 (IL-1) receptor families lead to the formation of a TRAF/TANK complex that mediates the activation of the transcription factor NF-kappa-B. This activation of NF-kappa-B occurs through an association with the kinases IKK-iota and TBK1. More recently, it was shown that these proteins can then form a complex with NEMO, a protein that regulates the activity of the Ikappa-B complex. This suggests that in addition to the possibility that TBK1 and IKK-iota activate the IKKs, the association with the IKK complex may help these kinases modulate other functions, such as the transactivation potential of NF-kappa-B proteins. At least two isoforms of TANK are known to exist.

Specifications

• Accession Number: Q92844
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10010
• Name: Human TANK (aa 7-90) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C86182; E430026L09Rik; ITRAF; I-TRAF; LOW QUALITY PROTEIN: TRAF family member-associated NF-kappa-B activator; OTTHUMP00000200694; OTTHUMP00000200695; OTTHUMP00000200696; OTTHUMP00000200698; OTTHUMP00000200700; OTTHUMP00000200703; OTTHUMP00000200704; TANK; TANK-like protein; TRAF family member associated NFKB activator; TRAF family member-associated Nf-kappa B activator; TRAF family member-associated NF-kappa-B activator; TRAF family member-associated NFKB activator; TRAF interacting protein TANK; TRAF2; TRAF-interacting protein; zgc:153048
• Common Name: TANK
• Gene Symbol: Tank
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining