Invitrogen™ Human TAOK1 (aa 895-997) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89799	100 μL

Catalog No. RP89799 Supplier Invitrogen™ Supplier No. RP89799

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAOK1 is a serine/threonine-protein kinase involved in regulation of the p38-containing stress-responsive MAP kinase pathway and extracellular signal-regulated protein kinase (ERK) kinases (MEKs). The activation of and binding to MEK3 by TAOK1 implicates TAOK1 in the regulation of the p38-containing stress-responsive MAP kinase pathway. A microtubule affinity-regulating kinase, TAOK1 (also known as MARKK) is an important regulator of mitotic progression, required for both chromosome congression and checkpoint-induced anaphase delay. TAOK1 is involved in various processes such as p38/MAPK14 stress-activated MAPK cascase, DNA damage response, and regulations of cytoskeleton stability. It phosphorylates MAP2K3, MAP2K6, and MARK2. TAOK1 acts as an activator of the p38/MAPK cascade by mediating phosphorylation and subsequent activation of the upsteam MAP2K3 and MAP2K6 kinases. It is involved in G-protein couples receptor signaling to p38/MAPK14. In response to DNA damage, TAOK1, is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade by phosphorylaton of MAP2K3 and MAP2K6. In addition, it acts as a regulator of cytoskeleton stability and a regulator of apoptosis.

Specifications

• Accession Number: Q7L7X3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57551
• Name: Human TAOK1 (aa 895-997) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810468K05Rik; AU020252; D130018F14Rik; FLJ14314; h hTAOK1; H KIAA1361; hKFC-B; hTAOK1; KFC-B; Kiaa1361; Kinase from chicken homolog B; MAP3K16; MARK Kinase; Markk; microtubule affinity regulating kinase kinase; mKIAA1361; prostate-derived STE20-like kinase 2; prostate-derived sterile 20-like kinase 2; PSK2; PSK-2; serine/threonine protein kinase TAO1; serine/threonine protein kinase TAO1 homolog; serine/threonine-protein kinase TAO1; STE20-like kinase PSK2; tao; TAO kinase 1; TAO1; TAOK1; Thousand and one amino acid protein 1; thousand and one amino acid protein kinase 1
• Common Name: TAOK1
• Gene Symbol: TAOK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining