Invitrogen™ Human TAPP1 (aa 113-188) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107371	100 μL

Catalog No. RP107371 Supplier Invitrogen™ Supplier No. RP107371

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66719. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphatidylinositol-4,5-bisphosphate 3-phosphatase adapter protein 1 (TAPP1) is a gene located on chromosome 1q25.2, encoding a protein involved in intracellular signaling pathways that regulate cellular processes such as proliferation, survival, and migration. TAPP1 is characterized by containing pleckstrin homology (PH) domains, which allow it to bind specifically to phosphoinositide lipids, particularly phosphatidylinositol (3,4) bisphosphate. This interaction is crucial for the localization of TAPP1 to cell membranes where it can act as an adaptor protein, modulating the activity of downstream signaling molecules and pathways. TAPP1 is expressed in various tissues and plays a role in immune cell function, influencing processes like cell motility and cytoskeletal dynamics. Research into TAPP1 focuses on its role in immune regulation and signaling, with implications for understanding its function in disease contexts such as cancer and autoimmune disorders where phosphoinositide signaling is disrupted.

Specifications

• Accession Number: Q9HB21
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 59338
• Name: Human TAPP1 (aa 113-188) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA960558; C920009D07Rik; PH domain-containing family A member 1; pleckstrin homology domain containing A1; pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1; pleckstrin homology domain-containing family A member 1; pleckstrin homology domain-containing protein family A member 1; PLEKHA1; RGD1564153; tandem PH domain containing protein-1; tandem PH domain-containing protein 1; TAPP1; TAPP-1
• Common Name: TAPP1
• Gene Symbol: PLEKHA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining