Invitrogen™ Human Tartrate Resistant Acid Phosphatase (aa 217-290) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103355	100 μL

Catalog No. RP103355 Supplier Invitrogen™ Supplier No. RP103355

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84419 (PA5-84419. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tartrate-resistant acid phosphatase (TRAP) is a basic iron-binding protein with high activity towards phosphoproteins, ATP and 4-nitrophenyl phosphatase. It is detected in human alveolar macrophages, osteoclasts, spleen and liver. Its expression is increased in spleen and monocytes of patients with Gaucher's disease; spleenocytes and circulating leukocytes of patients with hairy cell leukemia; spleen of patients with Hodgkin's lymphoma and in the sera of patients undergoing active bone turnover.

Specifications

• Accession Number: P13686
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54
• Name: Human Tartrate Resistant Acid Phosphatase (aa 217-290) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: acid phosphatase 5, tartrate resistant; acid phosphatase type V; Acp5; HPAP; human purple acid phosphatase; T5ap; Tartrate-resistant acid ATPase; tartrate-resistant acid phosphatase 5 A; tartrate-resistant acid phosphatase 5 b; tartrate-resistant acid phosphatase type 5; TRACP; TRACP5a; TRACP5b; TRAP; TR-AP; TRAPase; TrATPase; TTRRAP; Type 5 acid phosphatase
• Common Name: Tartrate Resistant Acid Phosphatase
• Gene Symbol: ACP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining